AK1 Antibody - N-terminal region - Biotin
Cat# ARP48148_P050-Biotin
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
AK1 Antibody - N-terminal region : Biotin (ARP48148_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-AK1 (ARP48148_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB, IHC |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AK1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 92%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%; Sheep: 92%; Zebrafish: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: HLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVN |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-AK1 (ARP48148_P050-Biotin) antibody is Catalog # AAP48148 (Previous Catalog # AAPP28659) |
| Reference | Quillen,E.E., (2006) J. Biol. Chem. 281 (30), 20728-20737 |
|---|---|
| Gene Symbol | AK1 |
| Gene Full Name | Adenylate kinase 1 |
| Alias Symbols | HTL-S-58j |
| NCBI Gene Id | 203 |
| Protein Name | Adenylate kinase isoenzyme 1 |
| Description of Target | Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | P00568 |
| Protein Accession # | NP_000467 |
| Nucleotide Accession # | NM_000476 |
| Protein Size (# AA) | 194 |
| Molecular Weight | 22kDa |
| Protein Interactions | UBC; IDH1; APP; TERF2IP; TINF2; TERF1; TRIM63; FHL2; KMT2C; |
