ADIPOR2 Antibody - C-terminal region
Cat# ARP60819_P050-25UL
Size : 25ul
Brand : Aviva Systems Biology
ADIPOR2 Antibody - C-terminal region (ARP60819_P050)
| Datasheets/Manuals | Printable datasheet for anti-ADIPOR2 (ARP60819_P050) antibody |
|---|
| Publications | Cornelian Cherry (Cornus mas L.) Fruit Extract Lowers SREBP-1c and C/EBPα in Liver and Alters Various PPAR-α, PPAR-γ, LXR-α Target Genes in Cholesterol-Rich Diet Rabbit Model Cornelian Cherry (Cornus mas L.) Fruit Extract Lowers SREBP-1c and C/EBPα in Liver and Alters Various PPAR-α, PPAR-γ, LXR-α Target Genes in Cholesterol-Rich Diet Rabbit Model Preprint — no PubMed record available Effects of Obesity on Adiponectin System Skin Expression in Dogs: A Comparative Study |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB, IHC |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 93%; Goat: 92%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: FPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFMIGGGCSEEDAL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ADIPOR2 (ARP60819_P050) antibody is Catalog # AAP60819 |
| Gene Symbol | ADIPOR2 |
|---|---|
| Gene Full Name | Adiponectin receptor 2 |
| Alias Symbols | PAQR2, ACDCR2 |
| NCBI Gene Id | 79602 |
| Protein Name | Adiponectin receptor protein 2 |
| Description of Target | The adiponectin receptors, ADIPOR1 and ADIPOR2, serve as receptors for globular and full-length adiponectin and mediate increased AMPK and PPAR-alpha ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin. |
| Uniprot ID | Q86V24 |
| Protein Accession # | NP_078827 |
| Nucleotide Accession # | NM_024551 |
| Protein Size (# AA) | 386 |
| Molecular Weight | 44kDa |
| Protein Interactions | UBC; APPL1; ADIPOQ; |





