ARP40077_P050-FITC | ZNF568 Antibody - N-terminal region

ZNF568 Antibody - N-terminal region : FITC (ARP40077_P050-FITC)

Datasheets/Manuals	Printable datasheet for anti-ZNF568 (ARP40077_P050-FITC) antibody

Product Info
Predicted Species Reactivity	Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
Product Format	Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality	Polyclonal
Host	Rabbit
Conjugation	FITC: Fluorescein Isothiocyanate
Application	WB
Reconstitution and Storage	All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF568
Purification	Affinity Purified
Predicted Homology Based on Immunogen Sequence	Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 100%; Sheep: 77%
Peptide Sequence	Synthetic peptide located within the following region: NLYRDVMLENYSNLVTVGCQVTKPDVIFKLEQEEEPWVMEEEMFGRHCPE
Concentration	0.5 mg/ml
Blocking Peptide	For anti-ZNF568 (ARP40077_P050-FITC) antibody is Catalog # AAP40077 (Previous Catalog # AAPP22932)

Reference	Kimura,K., (2006) Genome Res. 16 (1), 55-65
Gene Symbol	ZNF568
Gene Full Name	Zinc finger protein 568
Alias Symbols	ZFP568
NCBI Gene Id	374900
Protein Name	Zinc finger protein 568
Description of Target	The function of the Anti-ZNF568 gene has not yet been determined.
Uniprot ID	Q3ZCX4
Protein Accession #	NP_940941
Nucleotide Accession #	NM_198539
Protein Size (# AA)	644
Molecular Weight	74kDa
Protein Interactions	SUMO1; ILK; CBX5; UBC;