ZNF526 Antibody - N-terminal region - FITC
Referência ARP32148_P050-FITC
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
ZNF526 Antibody - N-terminal region : FITC (ARP32148_P050-FITC)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-ZNF526 (ARP32148_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF526 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: PPTPLPPPSPPSEVKMEPYECPECSTLCATPEEFLEHQGTHFDSLEKEER |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ZNF526 (ARP32148_P050-FITC) antibody is Catalog # AAP32148 (Previous Catalog # AAPP03114) |
| Gene Symbol | ZNF526 |
|---|---|
| Gene Full Name | Zinc finger protein 526 |
| Alias Symbols | DKFZp762O059, KIAA1951, MGC4267 |
| NCBI Gene Id | 116115 |
| Protein Name | Zinc finger protein 526 |
| Description of Target | ZNF526 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 13 C2H2-type zinc fingers. ZNF526 may be involved in transcriptional regulation. |
| Uniprot ID | Q8TF50 |
| Protein Accession # | NP_597701 |
| Nucleotide Accession # | NM_133444 |
| Protein Size (# AA) | 670 |
| Molecular Weight | 74kDa |
