ZNF509 Antibody - middle region - HRP
Referência ARP32201_P050-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
ZNF509 Antibody - middle region : HRP (ARP32201_P050-HRP)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-ZBTB49 (ARP32201_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Cow, Dog, Horse, Pig |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF509 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 77%; Horse: 100%; Human: 100%; Mouse: 85%; Pig: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: SAVLRRHKKMHCKAGDESPDVLEELSQAIETSDLEKSQSSDSFSQDTSVT |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ZBTB49 (ARP32201_P050-HRP) antibody is Catalog # AAP32201 (Previous Catalog # AAPP03174) |
| Reference | Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004) |
|---|---|
| Gene Symbol | ZBTB49 |
| Gene Full Name | Zinc finger and BTB domain containing 49 |
| Alias Symbols | ZNF509 |
| NCBI Gene Id | 166793 |
| Protein Name | Zinc finger protein 509 EMBL AAI09088.1 |
| Description of Target | The specific function of ZNF509 is not yet known. |
| Uniprot ID | Q32ML0 |
| Protein Accession # | NP_660334 |
| Nucleotide Accession # | NM_145291 |
| Protein Size (# AA) | 765 |
| Molecular Weight | 85kDa |
| Protein Interactions | ZBTB8A; CEP70; GOPC; TRAF2; POT1; HSP90AA1; |
