ZNF474 Antibody - N-terminal region - Biotin
Referência ARP32163_P050-Biotin
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
ZNF474 Antibody - N-terminal region : Biotin (ARP32163_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-ZNF474 (ARP32163_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF474 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 91%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 86%; Pig: 92%; Rat: 83% |
| Peptide Sequence | Synthetic peptide located within the following region: SDSYSSLSPETESVNPGENIKTDTQKKRPGTVILSKLSSRRIISESQLSP |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ZNF474 (ARP32163_P050-Biotin) antibody is Catalog # AAP32163 (Previous Catalog # AAPP03135) |
| Reference | Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004) |
|---|---|
| Gene Symbol | ZNF474 |
| Gene Full Name | Zinc finger protein 474 |
| Alias Symbols | FLJ32921 |
| NCBI Gene Id | 133923 |
| Protein Name | Zinc finger protein 474 |
| Description of Target | The specific function of ZNF474 is not yet known. |
| Uniprot ID | Q6S9Z5 |
| Protein Accession # | NP_997200 |
| Nucleotide Accession # | NM_207317 |
| Protein Size (# AA) | 364 |
| Molecular Weight | 40kDa |
| Protein Interactions | UBC; |
