ZNF419A antibody - C-terminal region
Referência ARP39607_T100
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
ZNF419A Antibody - C-terminal region (ARP39607_T100)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-ZNF419 (ARP39607_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF419A |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 91%; Pig: 85%; Rabbit: 92%; Rat: 83%; Sheep: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: GRLFRENSSLVKHQRVHTGAKPYECRECGKFFRHNSSLFKHRRIHTGEMQ |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-ZNF419 (ARP39607_T100) antibody is Catalog # AAP39607 (Previous Catalog # AAPP21627) |
| Reference | Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
|---|---|
| Gene Symbol | ZNF419 |
| Gene Full Name | Zinc finger protein 419 |
| Alias Symbols | ZAPHIR, ZNF419A |
| NCBI Gene Id | 79744 |
| Protein Name | Zinc finger protein 419 |
| Description of Target | ZNF419A contains 1 KRAB domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF419A may be involved in transcriptional regulation. |
| Uniprot ID | Q96HQ0 |
| Protein Accession # | NP_078967 |
| Nucleotide Accession # | NM_024691 |
| Protein Size (# AA) | 510 |
| Molecular Weight | 59kDa |
| Protein Interactions | KRTAP10-7; UBC; |
