TSG101 Antibody - middle region
Referência ARP37310_T100-25UL
Tamanho : 25ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
TSG101 Antibody - middle region (ARP37310_T100)
| Datasheets/Manuals | Printable datasheet for anti-TSG101 (ARP37310_T100) antibody |
|---|
| Publications | Efficient inhibition of infectious prions multiplication and release by targeting the exosomal pathway |
|---|---|
| Tested Species Reactivity | Mouse |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 93%; Horse: 79%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTSYMPGMPS |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-TSG101 (ARP37310_T100) antibody is Catalog # AAP37310 (Previous Catalog # AAPS05712) |
| Reference | Stefan,M., (er) BMC Genomics 6, 157 (2005) |
|---|---|
| Gene Symbol | TSG101 |
| Gene Full Name | Tumor susceptibility gene 101 |
| Alias Symbols | CC2, AI255943 |
| NCBI Gene Id | 22088 |
| Protein Name | Tumor susceptibility gene 101 protein |
| Description of Target | TSG101 has a direct role in the control of growth and differentiation in primary epithelial cells. It is required for normal cell function of embryonic and adult tissues but that this gene is not a tumor suppressor for sporadic forms of breast cancer. |
| Uniprot ID | Q61187 |
| Protein Accession # | NP_068684 |
| Nucleotide Accession # | NM_021884 |
| Protein Size (# AA) | 391 |
| Molecular Weight | 43kDa |
| Protein Interactions | Nr3c2; Ndfip1; SH3KBP1; Ppp1cc; Gjd3; Gjb3; Gjc1; Gja1; Ubc; Mgrn1; Tsg101; Nfe2; Ikbkg; Gmcl1; |
