TMX3 Recombinant Protein
Referência OPCA02414-100UG
Tamanho : 100ug
Marca : Aviva Systems Biology
TMX3 Recombinant Protein (Human) (OPCA02414)
| Datasheets/Manuals | Printable datasheet for TMX3 Recombinant Protein (Human) (OPCA02414) |
|---|
| Predicted Species Reactivity | Homo sapiens|Human |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Human |
| Additional Information | Relevance: Probable disulfide isomerase, which participates in the folding of proteins containing disulfide bonds. May act as a dithiol oxidase. |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | KGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEVIFKI |
| Protein Sequence | KGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEVIFKI |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 25-195 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.DNA Res. 8:85-95(2001) |
|---|---|
| Gene Symbol | TMX3 |
| Gene Full Name | thioredoxin related transmembrane protein 3 |
| Alias Symbols | PDIA13, protein disulfide isomerase family A, member 13, protein disulfide-isomerase TMX3, thioredoxin domain containing 10, thioredoxin domain-containing protein 10, Thioredoxin-related transmembrane protein 3, TXNDC10. |
| NCBI Gene Id | 54495 |
| Protein Name | Protein disulfide-isomerase TMX3 |
| Description of Target | Probable disulfide isomerase, which participates in the folding of proteins containing disulfide bonds. May act as a dithiol oxidase. |
| Uniprot ID | Q96JJ7 |
| Protein Accession # | NP_061895.3 |
| Nucleotide Accession # | NM_019022.3 |
| Protein Size (# AA) | Full Length of Isoform 2 |
| Molecular Weight | 35.6 kDa |


