Reagentes e instrumentos para imunologia, biologia celular e biologia molecular.
 
> Thyrotropin Releasing Hormone (TRH) (NM_007117) Human Recombinant Protein

Thyrotropin Releasing Hormone (TRH) (NM_007117) Human Recombinant Protein

Imprimir Imprimir
Please log in

Referência TP319231L

Tamanho : 1mg

Contactar o distribuidor local :


Telefone :

Thyrotropin Releasing Hormone (TRH) (NM_007117) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP319231L
Recombinant protein of human thyrotropin-releasing hormone (TRH), 1 mg
 

Other products for "Thyrotropin Releasing Hormone or NM_007117"

Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219231 protein sequence
Red=Cloning site Green=Tags(s)

MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQRLQGDQGEHS
ASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRR
SPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLL
GLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Cell treatment (PMID: 27806289)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_009048
Locus ID 7200
UniProt ID P20396
Cytogenetics 3q22.1
RefSeq Size 1890
RefSeq ORF 726
Synonyms Pro-TRH; TRF
Summary This gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-releasing hormone tripeptides. Thyrotropin-releasing hormone is involved in the regulation and release of thyroid-stimulating hormone, as well as prolactin. Deficiency of this hormone has been associated with hypothalamic hypothyroidism. provided by RefSeq, May 2013
Protein Categories Secreated Proteins
Protein Families Druggable Genome, Secreted Protein
FAQs
  • Protein FAQs
SDS

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.