TBR1 Antibody - middle region - FITC
Referência ARP31497_P050-FITC
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
TBR1 Antibody - middle region : FITC (ARP31497_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-TBR1 (ARP31497_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Cow, Dog, Pig |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TBR1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Human: 100%; Mouse: 86%; Pig: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: MAGANPYLGEEAEGLAAERSPLPPGAAEDAKPKDLSDSSWIETPSSIKSI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-TBR1 (ARP31497_P050-FITC) antibody is Catalog # AAP31497 (Previous Catalog # AAPP02259) |
| Reference | Hillier,L.W., (2005) Nature 434 (7034), 724-731 |
|---|---|
| Gene Symbol | TBR1 |
| Gene Full Name | T-box, brain, 1 |
| Alias Symbols | IDDAS, TBR-1, TES-56 |
| NCBI Gene Id | 10716 |
| Protein Name | T-box brain protein 1 |
| Description of Target | This gene is a member of a conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. A similar protein has been disrupted in mice and shown to be critical for early cortical development, and causes loss of projection neurons in the olfactory bulbs and olfactory cortex. The C-terminal region this similar protein was found to be necessary and sufficient for association with the guanylate kinase domain of calcium/calmodulin-dependent serine protein kinase.This gene is a member of a conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. A similar protein has been disrupted in mice and shown to be critical for early cortical development, and causes loss of projection neurons in the olfactory bulbs and olfactory cortex. The C-terminal region this similar protein was found to be necessary and sufficient for association with the guanylate kinase domain of calcium/calmodulin-dependent serine protein kinase. |
| Uniprot ID | Q16650 |
| Protein Accession # | NP_006584 |
| Nucleotide Accession # | NM_006593 |
| Protein Size (# AA) | 682 |
| Molecular Weight | 74kDa |
| Protein Interactions | UBC; CASK; TSPYL2; |
