Tamanho : 5mg
Telefone : +1 850 650 7790
Synonyms:
| Description | TAT-NSF222 Fusion Peptide is a bifunctional polypeptide comprising a TAT domain for cellular uptake via macropinocytosis and an NSF domain that inhibits N-ethylmaleimide-sensitive factor (NSF), serving as an exocytosis inhibitor [1]. |
| Sequence | Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Leu-Asp-Lys-Glu-Phe-Asn-Ser-Ile-Phe-Arg-Arg-Ala-Phe-Ala-Ser-Arg-Val-Phe-Pro-Pro-Glu |
| Sequence Short | YGRKKRRQRRRGGGLDKEFNSIFRRAFASRVFPPE |
| Storage | Keep away from moisture Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, and a total of 10 animals are to be administered, using a formulation of 
10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH2O , the resulting working solution concentration would be 2 mg/mL.Dissolve 2 mg of the compound in 100 μL DMSO to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO stock solution to 400 µL PEG300 and mix thoroughly until the solution becomes clear.
2) Add 50 µL Tween 80 and mix well until fully clarified.
3) Add 450 µL Saline,PBS or ddH2O and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|
