ST3GAL1 antibody - C-terminal region
Referência ARP45410_P050
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
ST3GAL1 Antibody - C-terminal region (ARP45410_P050)
| Datasheets/Manuals | Printable datasheet for anti-ST3GAL1 (ARP45410_P050) antibody |
|---|
| Publications | The disulfide catalyst QSOX1 maintains the colon mucosal barrier by regulating Golgi glycosyltransferases |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ST3GAL1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWEN |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ST3GAL1 (ARP45410_P050) antibody is Catalog # AAP45410 (Previous Catalog # AAPP26377) |
| Reference | Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693 |
|---|---|
| Gene Symbol | ST3GAL1 |
| Gene Full Name | ST3 beta-galactoside alpha-2,3-sialyltransferase 1 |
| Alias Symbols | ST3O, SIAT4A, SIATFL, ST3GalA, ST3GalIA, Gal-NAc6S, ST3GalA.1, ST3GalIA,1 |
| NCBI Gene Id | 6482 |
| Protein Name | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 |
| Description of Target | ST3GAL1 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. It is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of ST3GAL1 protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of the encoded protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B. Two transcript variants encoding the same protein have been found for this gene. Other transcript variants may exist, but have not been fully characterized yet. |
| Uniprot ID | Q11201 |
| Protein Accession # | NP_003024 |
| Nucleotide Accession # | NM_003033 |
| Protein Size (# AA) | 340 |
| Molecular Weight | 39 kDa |
| Protein Interactions | GSTA1; |
