Sst antibody - N-terminal region
Referência ARP41905_P050
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
Sst Antibody - N-terminal region (ARP41905_P050)
| Datasheets/Manuals | Printable datasheet for anti-Sst (ARP41905_P050) antibody |
|---|
| Tested Species Reactivity | Rat |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: LQKSLAAATGKQELAKYFLAELLSEPNQTENDALEPEDLPQAAEQDEMRL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Sst (ARP41905_P050) antibody is Catalog # AAP41905 |
| Gene Symbol | Sst |
|---|---|
| Gene Full Name | Somatostatin |
| Alias Symbols | S, SS, Sm, SOM, SRIF, Smst |
| NCBI Gene Id | 20604 |
| Protein Name | Somatostatin |
| Description of Target | Somatostatin inhibits the release of somatotropin. |
| Uniprot ID | P60041 |
| Protein Accession # | NP_033241 |
| Nucleotide Accession # | NM_009215 |
| Protein Size (# AA) | 116 |
| Molecular Weight | 13kDa |
