SOX2 Antibody - N-terminal region - FITC
Referência ARP31737_P050-FITC
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
SOX2 Antibody - N-terminal region : FITC (ARP31737_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-SOX2 (ARP31737_P050-FITC) antibody |
|---|
| Publications | Perry, K. J., Thomas, A. G. & Henry, J. J. Expression of pluripotency factors in larval epithelia of the frog Xenopus: evidence for the presence of cornea epithelial stem cells. Dev. Biol. 374, 281-94 (2013). IHC, Bovine, Pig, Human, Horse, Rat, Dog, Rabbit, Goat, Mouse, Sheep, Zebrafish 23274420 |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Sheep, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | IHC, WB |
| Additional Information | IHC Information: Kidney IHC Information: Thymus IHC Information: Spleen |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SOX2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 91% |
| Peptide Sequence | Synthetic peptide located within the following region: MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SOX2 (ARP31737_P050-FITC) antibody is Catalog # AAP31737 (Previous Catalog # AAPP02528) |
| Sample Type Confirmation | There is BioGPS gene expression data showing that SOX2 is expressed in OVCAR3 |
| Reference | Wang,P., (2008) Arch. Ophthalmol. 126 (5), 709-713 |
|---|---|
| Gene Symbol | SOX2 |
| Gene Full Name | SRY (sex determining region Y)-box 2 |
| Alias Symbols | ANOP3, MCOPS3 |
| NCBI Gene Id | 6657 |
| Protein Name | Transcription factor SOX-2 |
| Description of Target | SOX2 is a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The protein may act as a transcriptional activator after forming a protein complex with other proteins. Mutations in this gene have been associated with bilateral anophthalmia, a severe form of structural eye malformation. This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | P48431 |
| Protein Accession # | NP_003097 |
| Nucleotide Accession # | NM_003106 |
| Protein Size (# AA) | 317 |
| Molecular Weight | 34kDa |
| Protein Interactions | SUMO1; DMAP1; TBX2; SETD7; FAM21A; FZR1; MMS19; MRPS35; ZNF462; LSM2; CCAR2; MIER1; ZDBF2; CHD8; EP400; TSHZ3; RANBP10; ZNF687; XPO5; INTS2; MTA3; CORO1B; CASC5; MRPS22; KCMF1; MEPCE; TRERF1; INTS9; PARVA; SCYL2; CHD7; ZCCHC8; SOX6; BRIX1; SAMD4B; GID8; C |
