SOD1 Recombinant Protein (Brachydanio rerio)
Referência OPCA05078-100UG
Tamanho : 100ug
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
SOD1 Recombinant Protein (Zebrafish) (OPCA05078)
| Datasheets/Manuals | Printable datasheet for SOD1 Recombinant Protein (Zebrafish) (OPCA05078) |
|---|
| Predicted Species Reactivity | Danio rerio|Zebrafish |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Additional Information | Species Specificity Detail: Danio rerio (Zebrafish) (Brachydanio rerio) |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | Tris-base, 50% glycerol |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ |
| Protein Sequence | MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 1-154 aa |
| Tag | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| Reference | Comparative effects of dietary methylmercury on gene expression in liver, skeletal muscle, and brain of the zebrafish (Danio rerio). Gonzalez P., Dominique Y., Massabuau J.C., Boudou A., Bourdineaud J.P. Environ. Sci. Technol. 39:3972-3980(2005) |
|---|---|
| Gene Symbol | sod1 |
| Gene Full Name | superoxide dismutase 1, soluble |
| Alias Symbols | Cu-Zn superoxide dismutase, Cu/Zn-, Cu/Zn-SOD, cuz, cuzn, sod(Cu/, sod(Cu/Zn), superoxide dismutase [Cu-Zn], ZS, ZSOD. |
| NCBI Gene Id | 30553 |
| Protein Name | Superoxide dismutase [Cu-Zn] |
| Description of Target | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. |
| Uniprot ID | O73872 |
| Protein Accession # | NP_571369 |
| Nucleotide Accession # | NM_131294 |
| Protein Size (# AA) | Full Length |
| Molecular Weight | 37.1 kda |
