SMAD1 Antibody - middle region - HRP
Referência ARP32003_P050-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
SMAD1 Antibody - middle region : HRP (ARP32003_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-SMAD1 (ARP32003_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SMAD1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: LAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSST |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SMAD1 (ARP32003_P050-HRP) antibody is Catalog # AAP32003 (Previous Catalog # AAPP02904) |
| Specificity | This antibody reacts with SMAD1 + SMAD5. |
| Reference | Blount,A.L., (2008) J. Biol. Chem. 283 (11), 7016-7026 |
|---|---|
| Gene Symbol | SMAD1 |
| Gene Full Name | SMAD family member 1 |
| Alias Symbols | BSP1, JV41, BSP-1, JV4-1, MADH1, MADR1 |
| NCBI Gene Id | 4086 |
| Protein Name | Mothers against decapentaplegic homolog 1 |
| Description of Target | SMAD1 belongs to the SMAD family. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. SMAD1 mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, SMAD1 can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of SMAD1 forms a complex with SMAD4, which is important for its function in the transcription regulation. SMAD1 is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation.The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed.The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed. |
| Uniprot ID | Q15797 |
| Protein Accession # | NP_005891 |
| Nucleotide Accession # | NM_005900 |
| Protein Size (# AA) | 465 |
| Molecular Weight | 52kDa |
| Protein Interactions | HDAC1; SMURF1; WDR77; AR; UBC; ACVRL1; SMAD4; LEMD3; MAPK1; GSK3B; ZNF521; ZNF423; AKR1B1; AP2A2; PIAS4; ZDHHC3; HBP1; IRF2BP1; SF3B1; MGA; ZNF510; ICK; GMEB1; ZEB2; PUM1; PIGQ; PIAS1; TTF2; KMT2D; ZNF76; XPC; TTF1; SOX5; SNRNP70; SMAD3; SMAD2; SMAD1; INP |
