SLC25A6 Antibody - N-terminal region
Referência ARP58528_P050-25UL
Tamanho : 25ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
SLC25A6 Antibody - N-terminal region (ARP58528_P050)
| Datasheets/Manuals | Printable datasheet for anti-SLC25A6 (ARP58528_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A6 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SLC25A6 (ARP58528_P050) antibody is Catalog # AAP58528 (Previous Catalog # AAPP34692) |
| Reference | Yang,Z., (2007) Mol. Biol. Cell 18 (11), 4681-4689 |
|---|---|
| Gene Symbol | SLC25A6 |
| Gene Full Name | Solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 |
| Alias Symbols | ANT, AAC3, ANT3, ANT 2, ANT 3, ANT3Y |
| NCBI Gene Id | 293 |
| Protein Name | ADP/ATP translocase 3 |
| Description of Target | SLC25A6 catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. SLC25A6 may participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis. |
| Uniprot ID | Q6QRN9 |
| Protein Accession # | NP_001627 |
| Nucleotide Accession # | NM_001636 |
| Protein Size (# AA) | 298 |
| Molecular Weight | 33kDa |
| Protein Interactions | NOTCH2NL; TEKT4; LZTS2; MTUS2; MID2; HUWE1; TRIP6; TRAF1; KRT31; TRIM23; AP2B1; FAM96B; SUMO2; UBC; MDM2; ASB18; ASB14; ASB8; SMURF2; ZBTB1; HECW2; FBXO6; ADRB2; CLN5; CLN3; US3; HCVgp1; UBL4A; YWHAE; GRB2; TIMM9; TIMM10; TIMM13; NNT; UQCRC1; VAMP2; RPL10 |
