- Specifications
Product Description
Mouse monoclonal antibody raised against a full length recombinant RRAS2.
Immunogen
RRAS2 (AAH13106, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (48.18 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RRAS2 on formalin-fixed paraffin-embedded human dysgerminoma tissue. [antibody concentration 5 ug/ml]Immunofluorescence
Immunofluorescence of monoclonal antibody to RRAS2 on A-431 cell. [antibody concentration 10 ug/ml]ELISA
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RRAS2 is 1 ng/ml as a capture antibody.Western Blot (Cell lysate)
RRAS2 monoclonal antibody (M01), clone 2D3-4B8 Western Blot analysis of RRAS2 expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RRAS2 expression in transfected 293T cell line by RRAS2 monoclonal antibody (M01), clone 2D3-4B8.
Lane 1: RRAS2 transfected lysate (Predicted MW: 23.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
- Gene Info — RRAS2
- Interactomes
- Pathways
- Diseases
- Publication Reference
- The R-RAS2 GTPase is a signaling hub in triple-negative breast cancer cell metabolism and metastatic behavior.
Claudia Cifuentes, Lydia Horndler, Pilar Grosso, Clara L Oeste, Alejandro M Hortal, Jennifer Castillo, Isabel Fernández-Pisonero, Alberto Paradela, Xosé Bustelo, Balbino Alarcón.
Journal of Hematology & Oncology 2025 Apr; 18(1):41.
Application:IF, IHC, Co-IP, WB, Murine, BT-549, CBM-MBC21 murine breast cancer cell line..
- Antigen receptor ITAMs provide tonic signaling by acting as guanine nucleotide exchange factors to directly activate R-RAS2.
Alejandro M Hortal, Enrique Calleja, Clara L Oeste, Irene Arellano, Marta Lacuna, Soledad Blanco, Nadia Martín-Blanco, Inmaculada Montanuy, Antonio Alcamí, Xosé R Bustelo, Balbino Alarcón.
Science signaling 2025 Jan; 18(817):eadk4204.
Application:WB, Monkey, Human, COS-7, JK cells.
- Overexpression of wild type RRAS2, without oncogenic mutations, drives chronic lymphocytic leukemia.
Alejandro M Hortal, Clara L Oeste, Claudia Cifuentes, Miguel Alcoceba, Isabel Fernández-Pisonero, Laura Clavaín, Rut Tercero, Pilar Mendoza, Verónica Domínguez, Marta García-Flores, Belén Pintado, David Abia, Carmen García-Macías, Almudena Navarro-Bailón, Xosé R Bustelo, Marcos González, Balbino Alarcón.
Molecular cancer 2022 Feb; 21(1):35.
Application:WB-Ti, Mouse, Mouse leukemic cells.
- R-Ras subfamily proteins elicit distinct physiologic effects and phosphoproteome alterations in neurofibromin-null MPNST cells.
Shannon M Weber, Nicole M Brossier, Amanda Prechtl, Stephen Barnes, Landon S Wilson, Stephanie N Brosius, Jody Fromm Longo, Steven L Carroll.
Cell Communication and Signaling 2021 Sep; 19(1):95.
Application:WB-Ce, WB-Tr, Human, 90-8, ST88-14, NMS2, NMS2-PC, S462, STS-26T, T265-2c, YST-1 cells.
- High-efficiency unassisted transfection of platelets with naked double-stranded miRNAs modulates signal-activated translation and platelet function.
Sophia Lazar, Jeremy G T Wurtzel, Xi Chen, Peisong Ma, Lawrence E Goldfinger.
Platelets 2020 Aug; 1.
Application:WB-Tr, Human, Human platelets.
- TC21/RRas2 regulates GPVI-FcRγ-mediated platelet activation and thrombus stability.
Janapati S, Wurtzel J, Dangelmaier C, Manne BK, Bhavanasi D, Kostyak JC, Kim S, Holinstat M, Kunapuli SP, Goldfinger LE.
Journal of Thrombosis and Haemostasis 2018 Jun; [Epub].
Application:WB-Ce, Human, Mouse, Platelets, PBMCs.
- In vivo regulation of TGF-β by R-Ras2 revealed through loss of the RasGAP protein NF1.
Patmore DM, Welch S, Fulkerson PC, Wu J, Choi K, Eaves D, Kordich JJ, Collins MH, Cripe TP, Ratner N.
Cancer Research 2012 Oct; 72(20):5317.
Application:WB-Ti, Mouse, S462TY xenograft tumors.
- The R-RAS2 GTPase is a signaling hub in triple-negative breast cancer cell metabolism and metastatic behavior.
RRAS2 monoclonal antibody (M01), clone 2D3-4B8
Referência H00022800-M01
Tamanho : 100ug
Marca : Abnova
Images











