RRAD antibody - middle region
Referência ARP56566_P050
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
RRAD Antibody - middle region (ARP56566_P050)
| Datasheets/Manuals | Printable datasheet for anti-RRAD (ARP56566_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RRAD |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: LARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPG |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-RRAD (ARP56566_P050) antibody is Catalog # AAP56566 (Previous Catalog # AAPP39223) |
| Enhanced Validation | Relative Expression (Western Blot)  |
| Reference | Chang,L., (2007) Circulation 116 (25), 2976-2983 |
|---|---|
| Gene Symbol | RRAD |
| Gene Full Name | Ras-related associated with diabetes |
| Alias Symbols | RAD, RAD1, REM3 |
| NCBI Gene Id | 6236 |
| Protein Name | GTP-binding protein RAD |
| Description of Target | RRAD may play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca2+ currents. RRAD regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking to the cell membrane. RRAD inhibits cardiac hy |
| Uniprot ID | P55042 |
| Protein Accession # | NP_004156 |
| Nucleotide Accession # | NM_004165 |
| Protein Size (# AA) | 308 |
| Molecular Weight | 33kDa |
| Protein Interactions | PRKCA; PRKACA; CSNK2B; CSNK2A1; CAMK2G; CALM1; MMP14; TPM2; YWHAZ; PRKCB; NME1; |
