Recombinant Mouse C-X-C motif chemokine 14
Referência OPCA00814-20UG
Tamanho : 20ug
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
CXCL14 Recombinant Protein (Mouse) (OPCA00814)
| Datasheets/Manuals | Printable datasheet for CXCL14 Recombinant Protein (Mouse) (OPCA00814) |
|---|
| Predicted Species Reactivity | Mouse|Mus musculus |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Additional Information | Tag information : His tag |
| Reconstitution and Storage | -20°C or -80°C |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
| Protein Sequence | SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 23-99 aa |
| Tag | N-terminal 6xHis-tagged |
| Reference | Cloning of BRAK, a novel divergent CXC chemokine preferentially expressed in normal versus malignant cells.Hromas R., Broxmeyer H.E., Kim C., Nakshatri H., Christopherson K. II, Azam M., Hou Y.-H.Biochem. Biophys. Res. Commun. 255:703-706(1999) |
|---|---|
| Gene Symbol | Cxcl14 |
| Gene Full Name | chemokine (C-X-C motif) ligand 14 |
| Alias Symbols | 1110031L23Rik, 1200006I23Rik, AI414372, B-cell and monocyte-activating chemokine, BMAC, bolekine, BR, BRAK, C-X-C motif chemokine 14, chemokine BRAK, Kec, kidney-expressed chemokine CXC, KS1, MIP-, MIP-2g, MIP2gamma, musculus CXC chemokine MIP-2gamma, NJAC, Scyb1, Scyb14, small inducible cytokine subfamily B (Cys-X-Cys), member 14, small-inducible cytokine B14. |
| NCBI Gene Id | 57266 |
| Protein Name | C-X-C motif chemokine 14 |
| Description of Target | Chemotactic for CESS B-cells and THP-1 monocytes, but not T-cells. |
| Uniprot ID | Q9WUQ5 |
| Protein Size (# AA) | Full Length of Mature Protein |
| Molecular Weight | 13.4 kDa |
