Recombinant Human SYNGAP1 Protein, N-His

Referência NB-21-33581

Tamanho : 100µg

Marca : Neo Biotech

Contactar o distribuidor local :


Telefone : +1 850 650 7790

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96PV0
Molecular weight:
15.79 kDa
Ser1186–His1277

Specifications Recombinant Human SYNGAP1 Protein, N-His

Product name ARO-P10382-100
Uniprot ID Q96PV0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDH
Molecular weight 15.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser1186-His1277
Aliases /Synonyms Synaptic Ras GTPase-activating protein 1, Synaptic Ras-GAP 1, Neuronal RasGAP, SYNGAP1, KIAA1938, Ras/Rap GTPase-activating protein SynGAP
Reference ARO-P10382
Note For research use only.
Molecular Constructor
Ser1186–His1277
Product name ARO-P10382-1MG
Uniprot ID Q96PV0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDH
Molecular weight 15.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser1186-His1277
Aliases /Synonyms Synaptic Ras GTPase-activating protein 1, Synaptic Ras-GAP 1, Neuronal RasGAP, SYNGAP1, KIAA1938, Ras/Rap GTPase-activating protein SynGAP
Reference ARO-P10382
Note For research use only.
Molecular Constructor
Ser1186–His1277
Product name ARO-P10382-50
Uniprot ID Q96PV0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDH
Molecular weight 15.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser1186-His1277
Aliases /Synonyms Synaptic Ras GTPase-activating protein 1, Synaptic Ras-GAP 1, Neuronal RasGAP, SYNGAP1, KIAA1938, Ras/Rap GTPase-activating protein SynGAP
Reference ARO-P10382
Note For research use only.
Molecular Constructor
Ser1186–His1277

Documents

3D Representation

Recombinant Human SYNGAP1 Protein, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human SYNGAP1 Protein, N-His” Cancel reply

Related products

  • Anti-Human SYNGAP1 (Ser1186-His1277) Polyclonal Antibody binds to Recombinant Human SYNGAP1 Protein, N-His in WB Assay

    ARO-A12767

    Anti-Human SYNGAP1 (Ser1186-His1277) Polyclonal Antibody