Recombinant Human Protein PBMUCL2 (HCG22) - Mammalian cell
Referência CSB-MP522205HU-100ug
Tamanho : 100ug
Marca : Cusabio
Contactar o distribuidor local :
Telefone : +1 850 650 7790
| Abbreviation | Recombinant Human HCG22 protein |
| MSDS | |
| Image | |
Product Details
Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
HCG22
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
HLA complex group 22;Panbronchiolitis-related mucin-like protein 2
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
23-251aa
Target Protein Sequence
VNFGEKDAKVPGTWRDGVRVPGEGASWDSDRASPERRYGIVGLSQSISTKHPETSPKDSRIRENDVTADGRTTEDHITADPGTTEDSVTADPGTTEDNVTVDPGTTEGSVTADPATTKDYVSADPGTTKDSVTADPGTTENFVTADPGTTKDSITADPRTTEDSVTADPGTTKHSITVDPGTTEDSVTADPGTTKHSITADPGTTEDSVTADPGTTEDETTKHGDTHLL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to bring the contents to the bottom. Reconstitute the lyophilized protein in sterile deionized water to a recommended concentration of 0.1–1.0 mg/mL. If used immediately after reconstitution, glycerol is not required. If not for immediate use, after the protein is completely dissolved, add glycerol to a final concentration of 5%–50% (default: 50%), aliquot as needed, and store at -20℃/-80℃ for long-term storage. If dilution is needed during subsequent use, dilute with the same buffer as the protein, but without stabilizers (e.g., glycerol, trehalose, etc).
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Customer Reviews and Q&A
■ Customer Reviews
There are currently no reviews for this product.
Target Background
Gene References into Functions
- HCG22 expression is significantly upregulated in human masticatory mucosa during wound healing
- Study cloned 2 novel mucin-like genes designated panbronchiolitis related mucin-like 1 and 2 (PBMUCL1 and PBMUCL2) in the candidate region, which form a mucin-like gene cluster together with two adjacent genes.
- Observational study of gene-disease association. (HuGE Navigator)
Subcellular Location
Secreted.
Tissue Specificity
Detected in the brain, lung, spleen, thymus and prostate.
Database Links
HGNC:
OMIM:
KEGG:
UniGene: