PPP2CA Antibody - N-terminal region - HRP
Referência ARP56186_P050-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
PPP2CA Antibody - N-terminal region : HRP (ARP56186_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-PPP2CA (ARP56186_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human PPP2CA |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 93%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: FHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PPP2CA (ARP56186_P050-HRP) antibody is Catalog # AAP56186 |
| Gene Symbol | PPP2CA |
|---|---|
| Gene Full Name | protein phosphatase 2, catalytic subunit, beta isozyme |
| Alias Symbols | RP-C, PP2Ac, PP2CA, NEDLBA, PP2Calpha |
| NCBI Gene Id | 5515 |
| Protein Name | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform |
| Description of Target | This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit. |
| Uniprot ID | P67775-2 |
| Protein Size (# AA) | 255 |
| Molecular Weight | 28kDa |
| Protein Interactions | ZFP36; UBC; MID1; VAC14; SETBP1; PPP2R1A; SUMO2; ESPL1; HTT; VCP; ZNF346; NEDD8; SUMO1; RPA3; RPA2; RPA1; HNRNPH1; NIF3L1; TNPO3; AHCYL1; ARPC4; SSB; PFDN1; NRD1; TNPO1; IGBP1; XRN1; TRIP13; BAG3; STK26; CHEK2; STK25; POLA1; NPM1; STK24; CTDP1; RAF1; ID1; |
