POU6F1 Antibody - middle region - FITC
Referência ARP31433_P050-FITC
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
POU6F1 Antibody - middle region : FITC (ARP31433_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-POU6F1 (ARP31433_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human POU6F1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: YFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-POU6F1 (ARP31433_P050-FITC) antibody is Catalog # AAP31433 (Previous Catalog # AAPP02191) |
| Reference | Wey,E., et al., (1994) J. Biochem. 220 (3), 753-762 |
|---|---|
| Gene Symbol | POU6F1 |
| Gene Full Name | POU class 6 homeobox 1 |
| Alias Symbols | BRN5, MPOU, TCFB1 |
| NCBI Gene Id | 5463 |
| Protein Name | POU domain, class 6, transcription factor 1 |
| Description of Target | The POU6F1 gene encodes a protein that is part of a family of transcription factors which exhibit distinct temporal and spatial patterns of expression. |
| Uniprot ID | Q14863 |
| Protein Accession # | NP_002693 |
| Nucleotide Accession # | NM_002702 |
| Protein Size (# AA) | 301 |
| Molecular Weight | 33kDa |
