PLP1 antibody - N-terminal region

Referência ARP33843_P050

Tamanho : 100ul

Marca : Aviva Systems Biology

Contactar o distribuidor local :


Telefone : +1 850 650 7790

PLP1 Antibody - N-terminal region (ARP33843_P050)

Datasheets/ManualsPrintable datasheet for anti-PLP1 (ARP33843_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PLP1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 75%
Peptide SequenceSynthetic peptide located within the following region: GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL
Concentration0.5 mg/ml
Blocking PeptideFor anti-PLP1 (ARP33843_P050) antibody is Catalog # AAP33843 (Previous Catalog # AAPP04914)
ReferenceRegis,S., (2008) Clin. Genet. 73 (3), 279-287
Gene SymbolPLP1
Gene Full NameProteolipid protein 1
Alias SymbolsPLP, PMD, HLD1, MMPL, SPG2, GPM6C, PLP/DM20
NCBI Gene Id5354
Protein NameMyelin proteolipid protein
Description of TargetPLP1 is a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been identified for this gene.This gene encodes a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been identified for this gene.
Uniprot IDP60201
Protein Accession #NP_000524
Nucleotide Accession #NM_000533
Protein Size (# AA)277
Molecular Weight30kDa
Protein InteractionsPTPRN; CLN8; Htt; ITGAV; ITGA5; MAG; MBP; CANX; CALR;

Você também pode estar interessado nos seguintes produtos:



Referência
Descrição
Cond.
Price Bef. VAT
ARP41762_P050
 100ul 
ARP34484_P050
 100ul