- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant PLAG1.
Immunogen
PLAG1 (NP_002646, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Cell lysate)
PLAG1 monoclonal antibody (M02), clone 3B7. Western Blot analysis of PLAG1 expression in A-431.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PLAG1 is approximately 0.03ng/ml as a capture antibody.ELISA
- Gene Info — PLAG1
Entrez GeneID
5324GeneBank Accession#
NM_002655Protein Accession#
NP_002646Gene Name
PLAG1
Gene Alias
PSA, SGPA
Gene Description
pleiomorphic adenoma gene 1
Gene Ontology
HyperlinkGene Summary
Pleomorphic adenoma gene 1 encodes a zinc finger protein with 2 putative nuclear localization signals. PLAG1, which is developmentally regulated, has been shown to be consistently rearranged in pleomorphic adenomas of the salivary glands. PLAG1 is activated by the reciprocal chromosomal translocations involving 8q12 in a subset of salivary gland pleomorphic adenomas. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
Other Designations
Pleomorphic adenoma gene 1
- Interactomes
- Diseases
- Publication Reference
- Lipoblastoma Arising in the Head and Neck: A Clinicopathologic Analysis of 20 Cases.
Zahra Aldawood, Alyaa Al-Ibraheemi
Head and Neck Pathology 2023 Sep; 17(3):768.
Application:IHC, Human, Human lipoblastoma.
- HMGA2 Immunoexpression is frequent in salivary gland pleomorphic adenoma: immunohistochemical and molecular analyses of PLAG1 and HMGA2 in 25 cases.
Adepitan A Owosho, Olufunlola M Adesina, Oluwole Odujoko, Hezekiah Akinyemi, Akinwumi Komolafe, Simon Tadros, Robert Bauer, Kurt F Summersgill.
International Journal of Clinical and Experimental Pathology 2022 Feb; 15(2):63.
Application:IHC-P, Human, Human pleomorphic adenoma (salivary gland).
- SLUG is a key regulator of epithelial-mesenchymal transition in pleomorphic adenoma.
Hyesung Kim, Seung Bum Lee, Jae Kyung Myung, Jeong Hwan Park, Eunsun Park, Dong Il Kim, Cheol Lee, Younghoon Kim, Chul-Min Park, Min Bum Kim, Gil Chai Lim, Bogun Jang.
Laboratory Investigation; a Journal of Technical Methods and Pathology 2022 Jun; 102(6):631.
Application:IHC-P, Human, Human pleomorphic adenomas.
- The significance of tyrosine kinase receptor B and brain-derived neurotrophic factor expression in salivary duct carcinoma.
Yusuke Kondo, Kenichi Hirabayashi, Joaquim Carreras, Keiichi Tsukinoki, Yoshihide Ota, Kenji Okami, Naoya Nakamura.
Annals of Diagnostic Pathology 2020 Nov; 50:151673.
Application:IHC-P, Human, Human salivary duct carcinoma.
- Myoepithelioma of soft tissue and bone, and myoepithelioma-like tumors of the vulvar region: Clinicopathological study of 15 cases by PLAG1 immunohistochemistry.
Keiko Segawa, Shintaro Sugita, Tomoyuki Aoyama, Tomoko Takenami, Hiroko Asanuma, Yui Kojima, Yoshiaki Inayama, Tadashi Hasegawa.
Pathology International 2020 Dec; 70(12):965.
Application:IHC-P, Human, Human myoepitheliomas of soft tissue and bone, Human myoepithelioma-like tumors of the vulvar region.
- PLAG1 enhances the stemness profiles of acinar cells in normal human salivary glands in a cell type-specific manner.
Goto Y, Ibi M, Sato H, Tanaka J, Yasuhara R, Aota K, Azuma M, Fukada T, Mishima K, Irié T.
Journal of Oral Biosciences 2020 Mar; 62(1):99.
Application:WB-Tr, Human, Ductal NS-SV-DC, NS-SV-AC cells.
- Plag1 regulates neuronal gene expression and neuronal differentiation of neocortical neural progenitor cells.
Sakai H, Fujii Y, Kuwayama N, Kawaji K, Gotoh Y, Kishi Y.
Genes to Cells : Devoted to Molecular & Cellular Mechanisms 2019 Oct; 24(10):650.
Application:ChIP, Mouse, Neural progenitor cells.
- Low-grade intraductal carcinoma of salivary glands: A systematic review of this rare entity.
Giovacchini F, Bensi C, Belli S, Laurenti ME, Mandarano M, Paradiso D, Giansanti M, Tullio A.
Journal of Oral Biology and Craniofacial Research 2019 Jan; 9(1):96.
Application:IHC-P, Human, Intraductal carcinoma of salivary glands.
- miRNA deregulation by epigenetic silencing disrupts suppression of the oncogene PLAG1 in chronic lymphocytic leukemia.
Pallasch CP, Patz M, Park YJ, Hagist S, Eggle D, Claus R, Debey-Pascher S, Schulz A, Frenzel LP, Claasen J, Kutsch N, Krause G, Mayr C, Rosenwald A, Plass C, Schultze JL, Hallek M, Wendtner CM.
Blood 2009 Oct; 114(15):3255.
Application:WB-Ce, WB-Tr, Human, B cells, chronic lymphocytic leukemia cells, HeLa cells.
- Lipoblastoma Arising in the Head and Neck: A Clinicopathologic Analysis of 20 Cases.
PLAG1 monoclonal antibody (M02), clone 3B7
Referência H00005324-M02
Tamanho : 50ug
Marca : Abnova
Images