PFKL antibody - middle region
Referência ARP45774_T100
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
PFKL Antibody - middle region (ARP45774_T100)
| Datasheets/Manuals | Printable datasheet for anti-PFKL (ARP45774_T100) antibody |
|---|
| Publications | Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828 |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PFKL |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 79%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-PFKL (ARP45774_T100) antibody is Catalog # AAP45774 (Previous Catalog # AAPP26723) |
| Sample Type Confirmation | PFKL is supported by BioGPS gene expression data to be expressed in HepG2 |
| Gene Symbol | PFKL |
|---|---|
| Gene Full Name | Phosphofructokinase, liver |
| Alias Symbols | PFK-B, PFK-L, ATP-PFK |
| NCBI Gene Id | 5211 |
| Protein Name | ATP-dependent 6-phosphofructokinase, liver type |
| Description of Target | Phosphofructokinase (PFK) is a tetrameric enzyme that catalyzes a key step in glycolysis, namely the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate. PFK from muscle is a homotetramer of M subunit, PFK from liver is a homotetramer of L-subunits, while PFK from platelets can be composed of any tetrameric combination of M and L subunits. PFKL represents the L subunit. |
| Uniprot ID | P17858 |
| Protein Accession # | AAH18295 |
| Nucleotide Accession # | NM_002626 |
| Protein Size (# AA) | 568 |
| Molecular Weight | 64kDa |
| Protein Interactions | KRTAP10-7; GTPBP3; PFKL; KRTAP5-9; FUS; STAU1; UBC; EGFR; RNF2; rev; ZC3HC1; PSMD9; FBXO6; YWHAQ; HDAC6; PRPF40A; TESK1; PFKM; MYD88; ITGA4; FN1; PCBP3; PRDX3; PFKP; APP; ATN1; RAD21; SNW1; TERF2; ATG101; TAF13; TAF10; DMWD; COPS6; KRTAP4-12; |
