NSMCE1 antibody - N-terminal region
Referência ARP43407_T100
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
NSMCE1 Antibody - N-terminal region (ARP43407_T100)
| Datasheets/Manuals | Printable datasheet for anti-NSMCE1 (ARP43407_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NSMCE1 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 93%; Goat: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Peptide Sequence | Synthetic peptide located within the following region: RPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNIL |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-NSMCE1 (ARP43407_T100) antibody is Catalog # AAP43407 (Previous Catalog # AAPP11486) |
| Reference | Fujioka,Y., (2002) J. Biol. Chem. 277 (24), 21585-21591 |
|---|---|
| Gene Symbol | NSMCE1 |
| Gene Full Name | Non-SMC element 1 homolog (S. cerevisiae) |
| Alias Symbols | NSE1 |
| NCBI Gene Id | 197370 |
| Protein Name | Non-structural maintenance of chromosomes element 1 homolog |
| Description of Target | NSMCE1 is a probable component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. |
| Uniprot ID | Q8WV22 |
| Protein Accession # | NP_659547 |
| Nucleotide Accession # | NM_145080 |
| Protein Size (# AA) | 256 |
| Molecular Weight | 28kDa |
| Protein Interactions | UBC; EID3; SMC6; NDNL2; Ube2k; UBE2D2; NSMCE2; NSMCE1; NSMCE4A; SMC5; SUMO2; MAGEF1; |
