NKAIN4 (NM_152864) Human Tagged ORF Clone

Referência RC207239

Tamanho : 10ug

Contactar o distribuidor local :


Telefone :

NKAIN4 (NM_152864) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC207239
NKAIN4 (Myc-DDK-tagged)-Human Na+/K+ transporting ATPase interacting 4 (NKAIN4)
 
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NKAIN4
Synonyms bA261N11.2; C20orf58; FAM77A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207239 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTCCTGCTCCGGCCGCTGCGCGCTCGTCGTCCTCTGCGCTTTTCAGCTGGTCGCCGCCCTGGAGA
GGCAGGTGTTTGACTTCCTGGGCTACCAGTGGGCGCCCATCCTGGCCAACTTTGTCCACATCATCATCGT
CATCCTGGGACTCTTCGGCACCATCCAGTACCGGCTGCGCTATGTCATGGTGTACACGCTGTGGGCAGCC
GTCTGGGTCACCTGGAACGTCTTCATCATCTGCTTCTACCTGGAAGTCGGTGGCCTCTTAAAGGACAGCG
AGCTACTGACCTTCAGCCTCTCCCGGCATCGCTCCTGGTGGCGTGAGCGCTGGCCAGGCTGTCTGCATGA
GGAGGTGCCAGCAGTGGGCCTCGGGGCCCCCCATGGCCAGGCCCTGGTGTCAGGTGCTGGCTGTGCCCTG
GAGCCCAGCTATGTGGAGGCCCTACACAGTTGCCTGCAGATCCTGATCGCGCTTCTGGGCTTTGTCTGTG
GCTGCCAGGTGGTCAGCGTGTTTACGGATGAAGAGGACAGCTTTGATTTCATTGGTGGATTTGATCCATT
TCCTCTCTACCATGTCAATGAAAAGCCATCCAGTCTCTTGTCCAAGCAGGTGTACTTGCCTGCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207239 protein sequence
Red=Cloning site Green=Tags(s)

MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILGLFGTIQYRLRYVMVYTLWAA
VWVTWNVFIICFYLEVGGLLKDSELLTFSLSRHRSWWRERWPGCLHEEVPAVGLGAPHGQALVSGAGCAL
EPSYVEALHSCLQILIALLGFVCGCQVVSVFTDEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVYLPA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_152864
ORF Size 624 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_152864.2, NP_690603.2
RefSeq Size 1447 bp
RefSeq ORF 627 bp
Locus ID 128414
UniProt ID Q8IVV8
Cytogenetics 20q13.33
Protein Families Transmembrane
MW 23.2 kDa
Summary NKAIN4 is a member of a family of mammalian proteins (see NKAIN1; MIM 612871) with similarity to Drosophila Nkain and interacts with the beta subunit of Na,K-ATPase (ATP1B1; MIM 182330) (Gorokhova et al., 2007 PubMed 17606467).supplied by OMIM, Jun 2009
SKU Description Size
RC207239L3 Lenti ORF clone of Human Na+/K+ transporting ATPase interacting 4 (NKAIN4), Myc-DDK-tagged 10 ug
RC207239L4 Lenti ORF clone of Human Na+/K+ transporting ATPase interacting 4 (NKAIN4), mGFP tagged 10 ug
RG207239 NKAIN4 (tGFP-tagged) - Human Na+/K+ transporting ATPase interacting 4 (NKAIN4) 10 ug
SC125746 NKAIN4 (untagged)-Human Na+/K+ transporting ATPase interacting 4 (NKAIN4) 10 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Você também pode estar interessado nos seguintes produtos:



Referência
Descrição
Cond.
Price Bef. VAT
HY-13629-100mg
 100mg