Metallothionein-1 Recombinant Protein
Referência OPCA02086-100UG
Tamanho : 100ug
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
MT Recombinant Protein (Zebrafish) (OPCA02086)
| Datasheets/Manuals | Printable datasheet for MT Recombinant Protein (Zebrafish) (OPCA02086) |
|---|
| Predicted Species Reactivity | Danio rerio|Zebrafish |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Zebrafish |
| Additional Information | Relevance: Metallothioneins have a high content of cysteine residues that bind various heavy metals. |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | MDPCECAKTGACNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGTSCCQ |
| Protein Sequence | MDPCECAKTGACNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGTSCCQ |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 1-60 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | The use of metallothionein genes for determining the phylogenetic and evolutionary relationship between extant teleosts.Kille P., Olsson P.-E. |
|---|---|
| Gene Symbol | mt |
| Gene Full Name | metallothionein-1 |
| Alias Symbols | metallothionein A, metallothionein-1, MT-1, mt1. |
| NCBI Gene Id | 30282 |
| Protein Name | Metallothionein-1 |
| Description of Target | Metallothioneins have a high content of cysteine residues that bind various heavy metals. |
| Uniprot ID | P52722 |
| Protein Accession # | NP_571150.1 |
| Nucleotide Accession # | NM_131075.1 |
| Protein Size (# AA) | Full Length |
| Molecular Weight | 22 kda |