Lingual antimicrobial peptide Protein, Bubalus bubalis, Recombinant (His & KSI)

Referência NB-64-48992-500ug

Tamanho : 500ug

Marca : Neo Biotech

Contactar o distribuidor local :


Telefone : +1 850 650 7790

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Has bactericidal activity. Lingual antimicrobial peptide Protein, Bubalus bubalis, Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 19.8 kDa and the accession number is A3RJ36.
Species
Bubalus bubalis
Expression System
E. coli
TagN-6xHis-KSI
Accession NumberA3RJ36
Synonyms
Lingual antimicrobial peptide
Amino Acid
VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
Construction
25-64 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight19.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Has bactericidal activity.

Dose Conversion

You can also refer to dose conversion for different animals. More