Lingual antimicrobial peptide Protein, Bubalus bubalis, Recombinant (His & KSI)
Referência NB-64-48992-500ug
Tamanho : 500ug
Marca : Neo Biotech
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Has bactericidal activity. Lingual antimicrobial peptide Protein, Bubalus bubalis, Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 19.8 kDa and the accession number is A3RJ36. |
| Species | Bubalus bubalis |
| Expression System | E. coli |
| Tag | N-6xHis-KSI |
| Accession Number | A3RJ36 |
| Synonyms | Lingual antimicrobial peptide |
| Amino Acid | VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK |
| Construction | 25-64 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 19.8 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Has bactericidal activity. |
Dose Conversion
You can also refer to dose conversion for different animals. More

