lepB Recombinant Protein
Referência OPCA02224-20UG
Tamanho : 20ug
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
LEPB Recombinant Protein (Mycobacterium tuberculosis) (OPCA02224)
| Datasheets/Manuals | Printable datasheet for LEPB Recombinant Protein (Mycobacterium tuberculosis) (OPCA02224) |
|---|
| Predicted Species Reactivity | Mycobacterium tuberculosis |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Mycobacterium tuberculosis |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | RPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR |
| Protein Sequence | RPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 88-294 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.Kelkar D.S., Kumar D., Kumar P., Balakrishnan L., Muthusamy B., Yadav A.K., Shrivastava P., Marimuthu A., Anand S., Sundaram H., Kingsbury R., Harsha H.C., Nair B., Prasad T.S., Chauhan D.S., Katoch K., Katoch V.M., Kumar P. , Chaerkady R., Ramachandran S., Dash D., Pandey A.Mol. Cell. Proteomics 10:M111.011627-M111.011627(2011) |
|---|---|
| Gene Symbol | lepB |
| Gene Full Name | signal peptidase |
| Alias Symbols | Leader peptidase I, Rv2903c, signal peptidase. |
| NCBI Gene Id | 887157 |
| Protein Name | Signal peptidase I |
| Uniprot ID | P9WKA1 |
| Protein Accession # | NP_217419.1 |
| Nucleotide Accession # | NC_000962.3 |
| Protein Size (# AA) | Extracellular Domain |
| Molecular Weight | 38.6 kda |