IRF6 Antibody - middle region - Biotin
Referência ARP31995_P050-Biotin
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
IRF6 Antibody - middle region : Biotin (ARP31995_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-IRF6 (ARP31995_P050-Biotin) antibody |
|---|
| Publications | Iwata, J. et al. Smad4-Irf6 genetic interaction and TGFβ-mediated IRF6 signaling cascade are crucial for palatal fusion in mice. Development 140, 1220-30 (2013). WB, Human, Rat, Dog, Pig, Horse, Rabbit, Bovine, Mouse, Sheep, Guinea pig, Zebrafish 23406900 |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IRF6 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 85% |
| Peptide Sequence | Synthetic peptide located within the following region: IPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQ |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-IRF6 (ARP31995_P050-Biotin) antibody is Catalog # AAP31995 (Previous Catalog # AAPP02892) |
| Reference | Vieira,A.R., (er) Arch. Oral Biol. (2008) In press |
|---|---|
| Gene Symbol | IRF6 |
| Gene Full Name | Interferon regulatory factor 6 |
| Alias Symbols | LPS, PIT, PPS, VWS, OFC6, PPS1, VWS1 |
| NCBI Gene Id | 3664 |
| Protein Name | Interferon regulatory factor 6 |
| Description of Target | IRF6 is a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in its gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation.The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction. This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | O14896 |
| Protein Accession # | NP_006138 |
| Nucleotide Accession # | NM_006147 |
| Protein Size (# AA) | 467 |
| Molecular Weight | 53kDa |
| Protein Interactions | HHV8GK18_gp81; UBC; BNC2; IRF5; IRF8; ZBTB3; RFX3; TLX2; LBP; |
