HOXB5 Antibody - N-terminal region - HRP
Referência ARP31444_P050-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
HOXB5 Antibody - N-terminal region : HRP (ARP31444_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-HOXB5 (ARP31444_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB5 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-HOXB5 (ARP31444_P050-HRP) antibody is Catalog # AAP31444 (Previous Catalog # AAPP02206) |
| Reference | Fu,M., et al., (2003) Dev. Dyn. 228 (1), |
|---|---|
| Gene Symbol | HOXB5 |
| Gene Full Name | Homeobox B5 |
| Alias Symbols | HOX2, HU-1, HOX2A, Hox2.1, HHO.C10 |
| NCBI Gene Id | 3215 |
| Protein Name | Homeobox protein Hox-B5 |
| Description of Target | HOXB5 belongs to the homeobox family. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17. The exact role of this gene has yet to be determined.This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue. |
| Uniprot ID | P09067 |
| Protein Accession # | NP_002138 |
| Nucleotide Accession # | NM_002147 |
| Protein Size (# AA) | 269 |
| Molecular Weight | 30kDa |
| Protein Interactions | MAGEA11; CTBP2; CTBP1; TRIM23; UBC; |
