Histone H4 Protein, Human, Recombinant (His)
Referência NB-64-127256-500ug
Tamanho : 500ug
Marca : Neo Biotech
Remove All
Histone H4 Protein, Human, Recombinant (His)
(Synonyms: Histone H4, HIST4H4, HIST2H4B, HIST2H4A, HIST2H4, HIST1H4L, HIST1H4K, HIST1H4J, HIST1H4I, HIST1H4H, HIST1H4F, HIST1H4E, HIST1H4D, HIST1H4C, HIST1H4B, HIST1H4A, H4FO, H4FN, H4FM, H4FK, H4FJ, H4FI, H4FH, H4FG, H4FE, H4FD, H4FC, H4FB, H4FA, H4F2, H4C9, H4C8, H4C6, H4C5, H4C4, H4C3, H4C2, H4C16, H4C15, H4C14, H4C13, H4C12, H4C11, H4C1, H4-16, H4/O, H4/N, H4/M, H4/K, H4/J, H4/I, H4/H, H4/G, H4/E, H4/D, H4/C, H4/B, H4/A) Copy Product InfoSynonyms: Histone H4, HIST4H4, HIST2H4B, HIST2H4A, HIST2H4, HIST1H4L, HIST1H4K, HIST1H4J, HIST1H4I, HIST1H4H, HIST1H4F, HIST1H4E, HIST1H4D, HIST1H4C, HIST1H4B, HIST1H4A, H4FO, H4FN, H4FM, H4FK, H4FJ, H4FI, H4FH, H4FG, H4FE, H4FD, H4FC, H4FB, H4FA, H4F2, H4C9, H4C8, H4C6, H4C5, H4C4, H4C3, H4C2, H4C16, H4C15, H4C14, H4C13, H4C12, H4C11, H4C1, H4-16, H4/O, H4/N, H4/M, H4/K, H4/J, H4/I, H4/H, H4/G, H4/E, H4/D, H4/C, H4/B, H4/A
Catalog No. TMPH-03960 Copy Product Info
Histone H4 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P62805.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | Histone H4 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P62805. |
| Species | Human |
| Expression System | E. coli |
| Tag | C-6xHis |
| Accession Number | P62805 |
| Amino Acid | SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
| Construction | 2-103 aa |
| Protein Purity | >85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Histone H4, HIST4H4, HIST2H4B, HIST2H4A, HIST2H4, HIST1H4L, HIST1H4K, HIST1H4J, HIST1H4I, HIST1H4H, HIST1H4F, HIST1H4E, HIST1H4D, HIST1H4C, HIST1H4B, HIST1H4A, H4FO, H4FN, H4FM, H4FK, H4FJ, H4FI, H4FH, H4FG, H4FE, H4FD, H4FC, H4FB, H4FA, H4F2, H4C9, H4C8, H4C6, H4C5, H4C4, H4C3, H4C2, H4C16, H4C15, H4C14, H4C13, H4C12, H4C11, H4C1, H4-16, H4/O, H4/N, H4/M, H4/K, H4/J, H4/I, H4/H, H4/G, H4/E, H4/D, H4/C, H4/B, H4/A |
| Molecular Weight | 18.1 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
HIST4H 4HIST2H 4H4F 2H4C 9H4C 8H4C 6H4C 5H4C 4H4C 3H4C 2H4C 16H4C 15H4C 14H4C 13H4C 12H4C 11H4C 1H416
Related Tags: Histone H4 Protein, Human, Recombinant (His) chemical structure | Histone H4 Protein, Human, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

