GCNT3 antibody - C-terminal region
Referência ARP43526_T100
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
GCNT3 Antibody - C-terminal region (ARP43526_T100)
| Datasheets/Manuals | Printable datasheet for anti-GCNT3 (ARP43526_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Yeast |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Additional Information | IHC Information: Transfected 293T cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%. |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GCNT3 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 91%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%; Sheep: 93%; Yeast: 89% |
| Peptide Sequence | Synthetic peptide located within the following region: AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-GCNT3 (ARP43526_T100) antibody is Catalog # AAP43526 (Previous Catalog # AAPP11518) |
| Reference | Tan,S. (2007) Am. J. Respir. Cell Mol. Biol. 36 (6), 737-745 |
|---|---|
| Gene Symbol | GCNT3 |
| Gene Full Name | Glucosaminyl (N-acetyl) transferase 3, mucin type |
| Alias Symbols | GNTM, C24GNT, C2GNT2, C2GNTM, C2/4GnT |
| NCBI Gene Id | 9245 |
| Protein Name | Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 |
| Description of Target | This enzyme catalyzes O-glycan branch synthesis of the core 2 and core 4 type in mucins and controls expression of core 2 branched oligosaccharides and I antigens on the cell surface.This enzyme catalyzes O-glycan branch synthesis of the core 2 and core 4 type in mucins and controls expression of core 2 branched oligosaccharides and I antigens on the cell surface. |
| Uniprot ID | O95395 |
| Protein Accession # | NP_004742 |
| Nucleotide Accession # | NM_004751 |
| Protein Size (# AA) | 438 |
| Molecular Weight | 51kDa |
| Protein Interactions | DHRSX; RBM18; SNUPN; CASK; |