GCG antibody - N-terminal region
Referência ARP42010_T100
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
GCG Antibody - N-terminal region (ARP42010_T100)
| Datasheets/Manuals | Printable datasheet for anti-GCG (ARP42010_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GCG |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 75% |
| Peptide Sequence | Synthetic peptide located within the following region: LSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-GCG (ARP42010_T100) antibody is Catalog # AAP42010 (Previous Catalog # AAPS11503) |
| Reference | Meier,J.J., (2006) Gastroenterology 130 (1), 44-54 |
|---|---|
| Gene Symbol | GCG |
| Gene Full Name | Glucagon |
| Alias Symbols | GLP1, GLP2, GRPP, GLP-1 |
| NCBI Gene Id | 2641 |
| Protein Name | Glucagon |
| Description of Target | GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. |
| Uniprot ID | P01275 |
| Protein Accession # | NP_002045 |
| Nucleotide Accession # | NM_002054 |
| Protein Size (# AA) | 180 |
| Molecular Weight | 20kDa |
| Protein Interactions | ARRB2; GLP1R; GLP2R; MEP1B; MEP1A; GCGR; CTSL; CPE; |
