FGD1 Antibody - C-terminal region - Biotin
Referência ARP31673_P050-Biotin
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
FGD1 Antibody - C-terminal region : Biotin (ARP31673_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-FGD1 (ARP31673_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FGD1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 86%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 79%; Rat: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: WMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDKT |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-FGD1 (ARP31673_P050-Biotin) antibody is Catalog # AAP31673 (Previous Catalog # AAPP02460) |
| Sample Type Confirmation | FGD1 is supported by BioGPS gene expression data to be expressed in Raji |
| Reference | Lebel,R.R., et al., (2002) Clin. Genet. 61 (2), 139-145 |
|---|---|
| Gene Symbol | FGD1 |
| Gene Full Name | FYVE, RhoGEF and PH domain containing 1 |
| Alias Symbols | AAS, FGDY, MRXS16, ZFYVE3 |
| NCBI Gene Id | 2245 |
| Protein Name | FYVE, RhoGEF and PH domain-containing protein 1 |
| Description of Target | FGD1 contains Dbl (DH) and pleckstrin (PH) homology domains. It can bind specifically to the Rho family GTPase Cdc42Hs and stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. FGD1 has an essential role in embryonic development, and FGD1 gene mutations result in the human developmental disorder, Aarskog-Scott syndrome. |
| Uniprot ID | P98174 |
| Protein Accession # | NP_004454 |
| Nucleotide Accession # | NM_004463 |
| Protein Size (# AA) | 961 |
| Molecular Weight | 107kDa |
| Protein Interactions | BTRC; UBC; ELAVL1; ELMO1; CTTN; CDC42; AOC1; |
