- Specifications
Product Description
Human DNMT3A partial ORF ( AAH43617, 803 a.a. - 912 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.95
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — DNMT3A
Entrez GeneID
1788GeneBank Accession#
BC043617Protein Accession#
AAH43617Gene Name
DNMT3A
Gene Alias
DNMT3A2, M.HsaIIIA
Gene Description
DNA (cytosine-5-)-methyltransferase 3 alpha
Omim ID
602769Gene Ontology
HyperlinkGene Summary
CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
DNA MTase HsaIIIA|DNA cytosine methyltransferase 3 alpha|DNA cytosine methyltransferase 3A2|DNA methyltransferase HsaIIIA|OTTHUMP00000120005|OTTHUMP00000120006
- Interactomes
- Pathways
- Diseases
DNMT3A (Human) Recombinant Protein (Q01)
Referência H00001788-Q01
Tamanho : 10ug
Marca : Abnova
DNMT3A (Human) Recombinant Protein (Q01)
Images


