ClfA Protein, S. aureus (strain COL), Recombinant (His)
Referência NB-64-52200-50ug
Tamanho : 50ug
Marca : Neo Biotech
Contactar o distribuidor local :
Telefone : +1 850 650 7790
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps. ClfA Protein, S. aureus (strain COL), Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 38.0 kDa and the accession number is Q5HHM8. |
| Species | Staphylococcus aureus |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis |
| Accession Number | Q5HHM8 |
| Synonyms | Fibrinogen-binding protein A,Fibrinogen receptor A,Clumping factor A,clfA |
| Amino Acid | GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE |
| Construction | 229-559 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 38.0 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps. |
Dose Conversion
You can also refer to dose conversion for different animals. More