CBLL2 Antibody - middle region - HRP
Referência ARP39909_P050-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
CBLL2 Antibody - middle region : HRP (ARP39909_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-CBLL2 (ARP39909_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Dog, Yeast |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF645 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Dog: 75%; Human: 100%; Yeast: 85% |
| Peptide Sequence | Synthetic peptide located within the following region: LSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQRRHRR |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-CBLL2 (ARP39909_P050-HRP) antibody is Catalog # AAP39909 (Previous Catalog # AAPP10223) |
| Reference | Ross,M.T., (2005) Nature 434 (7031), 325-337 |
|---|---|
| Gene Symbol | CBLL2 |
| Gene Full Name | Cbl proto-oncogene like 2 |
| Alias Symbols | CT138, HAKAIL, ZNF645 |
| NCBI Gene Id | 158506 |
| Protein Name | E3 ubiquitin-protein ligase CBLL2 |
| Description of Target | This gene encodes a member of the zinc finger domain-containing protein family. This family member contains both a RING-type and a C2H2-type of zinc finger domain, and it may function as an E3 ubiquitin-protein ligase. Protein localization suggests a role in human sperm production and quality control. |
| Uniprot ID | Q8N7E2 |
| Protein Accession # | NP_689790 |
| Nucleotide Accession # | NM_152577 |
| Protein Size (# AA) | 425 |
| Molecular Weight | 49kDa |
| Protein Interactions | UBC; |
