PX-P4721
Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)
Referência NB-21-24362
Tamanho : 50ug
| Product name | Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A) |
|---|---|
| Uniprot ID | P50416 |
| Uniprot link | https://www.uniprot.org/uniprot/P50416 |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET |
| Molecular weight | 38.45 kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS pH 7.5, 0.02% SKL |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Gln406-Thr745 |
| Protein Accession | P50416 |
| Spec:Entrez GeneID | 1374 |
| Spec:NCBI Gene Aliases | CPT1; CPT1-L; L-CPT1 |
| Spec:SwissProtID | Q8TCU0 |
| NCBI Reference | P50416 |
| Aliases /Synonyms | CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1 |
| Reference | PX-P4721 |
| Note | For research use only |
| Molecular Constructor | His Gln406–Thr745 |
| Product name | Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A) |
|---|---|
| Uniprot ID | P50416 |
| Uniprot link | https://www.uniprot.org/uniprot/P50416 |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET |
| Molecular weight | 38.45 kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS pH 7.5, 0.02% SKL |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Gln406-Thr745 |
| Protein Accession | P50416 |
| Spec:Entrez GeneID | 1374 |
| Spec:NCBI Gene Aliases | CPT1; CPT1-L; L-CPT1 |
| Spec:SwissProtID | Q8TCU0 |
| NCBI Reference | P50416 |
| Aliases /Synonyms | CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1 |
| Reference | PX-P4721 |
| Note | For research use only |
| Molecular Constructor | His Gln406–Thr745 |
| Product name | PX-P4721-1MG |
|---|---|
| Uniprot ID | P50416 |
| Uniprot link | https://www.uniprot.org/uniprot/P50416 |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET |
| Molecular weight | 38.45 kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS pH 7.5, 0.02% SKL |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Gln406-Thr745 |
| Protein Accession | P50416 |
| Spec:Entrez GeneID | 1374 |
| Spec:NCBI Gene Aliases | CPT1; CPT1-L; L-CPT1 |
| Spec:SwissProtID | Q8TCU0 |
| NCBI Reference | P50416 |
| Aliases /Synonyms | CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1 |
| Reference | PX-P4721 |
| Note | For research use only |
| Molecular Constructor | His Gln406–Thr745 |
There are no reviews yet.