BTNL3 antibody - N-terminal region
Referência ARP46769_P050
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
BTNL3 Antibody - N-terminal region (ARP46769_P050)
| Datasheets/Manuals | Printable datasheet for anti-BTNL3 (ARP46769_P050) antibody |
|---|
| Publications | Butyrophilin-like 3 Directly Binds a Human Vγ4+ T Cell Receptor Using a Modality Distinct from Clonally-Restricted Antigen |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Cow, Horse, Pig |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human BTNL3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 77%; Horse: 77%; Human: 100%; Pig: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: EDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-BTNL3 (ARP46769_P050) antibody is Catalog # AAP46769 (Previous Catalog # AAPP27568) |
| Enhanced Validation | Relative Expression (Western Blot)  |
| Reference | Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270 |
|---|---|
| Gene Symbol | BTNL3 |
| Gene Full Name | Butyrophilin-like 3 |
| Alias Symbols | BTNLR, BTN9.1 |
| NCBI Gene Id | 10917 |
| Protein Name | Butyrophilin-like protein 3 |
| Description of Target | The specific function of BTNL3 is not yet known. |
| Uniprot ID | Q6UXE8 |
| Protein Accession # | NP_932079 |
| Nucleotide Accession # | NM_197975 |
| Protein Size (# AA) | 466 |
| Molecular Weight | 52 kDa |
