BCKDHA Antibody - N-terminal region - Biotin
Referência ARP56119_P050-Biotin
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
BCKDHA Antibody - N-terminal region : Biotin (ARP56119_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-BCKDHA (ARP56119_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human BCKDHA |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-BCKDHA (ARP56119_P050-Biotin) antibody is Catalog # AAP56119 (Previous Catalog # AAPP37740) |
| Sample Type Confirmation | BCKDHA is supported by BioGPS gene expression data to be expressed in MCF7 |
| Subunit | alpha, mitochondrial |
| Reference | Flaschker,N., (2007) J. Inherit. Metab. Dis. 30 (6), 903-909 |
|---|---|
| Gene Symbol | BCKDHA |
| Gene Full Name | Branched chain keto acid dehydrogenase E1, alpha polypeptide |
| Alias Symbols | MSU, MSUD1, OVD1A, BCKDE1A |
| NCBI Gene Id | 593 |
| Protein Name | 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial |
| Description of Target | The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).The BCKDHA gene encodes the E1-alpha subunit of the branched-chain alpha-keto acid (BCAA) dehydrogenase complex (BCKD; EC 1.2.4.4), an inner-mitochondrial enzyme complex that catalyzes the oxidative decarboxylation of the branched-chain alpha-ketoacids derived from isoleucine, leucine, and valine. This reaction is the second major step in the catabolism of the branched-chain amino acids (Wynn et al., 1998 [PubMed 9582350]). The BCKD complex consists of 3 catalytic components: a heterotetrameric (alpha2-beta2) branched-chain alpha-keto acid decarboxylase (E1), a homo-24-meric dihydrolipoyl transacylase (E2; MIM 248610), and a homodimeric dihydrolipoamide dehydrogenase (E3; MIM 238331). E1 is a thiamine pyrophosphate (TPP)-dependent enzyme. The reaction is irreversible and constitutes the first committed step in BCAA oxidation. The BCKDHB gene (MIM 248611) encodes the beta subunit of E1. The complex also contains 2 regulatory enzymes, a kinase and a phosphorylase.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-675 BI910860.1 12-686 676-1196 BG742673.1 80-600 1197-1731 BM702667.1 48-582 1732-1763 BE223026.1 1-32 c 1764-1781 BQ018849.1 1-18 c |
| Uniprot ID | P12694 |
| Protein Accession # | NP_000700 |
| Nucleotide Accession # | NM_000709 |
| Protein Size (# AA) | 445 |
| Molecular Weight | 50kDa |
| Protein Interactions | UBC; CUL3; BCKDHB; BCKDK; |
