Avil Antibody - N-terminal region - HRP
Referência ARP31494_P050-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
Avil Antibody - N-terminal region : HRP (ARP31494_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-Avil (ARP31494_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 93%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: SGERLXXXXXXKAMLLAKDIRDREGGGRAEIGVIEGDKEAASPELMTVLQ |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Avil (ARP31494_P050-HRP) antibody is Catalog # AAP31494 (Previous Catalog # AAPP24076) |
| Gene Symbol | Avil |
|---|---|
| Gene Full Name | Advillin |
| Alias Symbols | - |
| NCBI Gene Id | 79253 |
| Protein Name | Advillin |
| Description of Target | Avil is a Ca2+-regulated actin-binding protein. It may have a unique function in the morphogenesis of neuronal cells which form ganglia. It is required for SREC1-mediated regulation of neurite-like outgrowth. It plays a role in regenerative sensory axon outgrowth and remodeling processes after peripheral injury in neonates. It is involved in the formation of long fine actin-containing filopodia-like structures in fibroblast and is required for SREC1-mediated regulation of neurite-like outgrowth. Avil plays a role in ciliogenesis. |
| Uniprot ID | Q9WU06 |
| Protein Accession # | NP_077377 |
| Nucleotide Accession # | NM_024401 |
| Protein Size (# AA) | 829 |
| Molecular Weight | 91kDa |
