Apbb1 Antibody - N-terminal region - Biotin

Referência ARP55471_P050-Biotin

Tamanho : 100ul

Marca : Aviva Systems Biology

Contactar o distribuidor local :


Telefone : +1 850 650 7790

Apbb1 Antibody - N-terminal region : Biotin (ARP55471_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-Apbb1 (ARP55471_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: DGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNP
Concentration0.5 mg/ml
Blocking PeptideFor anti-Apbb1 (ARP55471_P050-Biotin) antibody is Catalog # AAP55471 (Previous Catalog # AAPP33363)
Gene SymbolApbb1
Gene Full NameAmyloid beta (A4) precursor protein-binding, family B, member 1
Alias SymbolsRir, Fe65
NCBI Gene Id11785
Protein NameAmyloid beta A4 precursor protein-binding family B member 1
Description of TargetApbb1 is an adapter protein that forms a transcriptionally active complex with the gamma-secretase-derived amyloid precursor protein (APP) intracellular domain.Apbb1 plays a central role in the response to DNA damage by translocating to the nucleus and inducing apoptosis. Apbb1 may act by specifically recognizing and binding histone H2AX phosphorylated on 'Tyr-142' (H2AXY142ph) at double-strand breaks (DSBs), recruiting other pro-apoptosis factors such as MAPK8/JNK1. Apbb1 is required for histone H4 acetylation at double-strand breaks (DSBs). Its ability to specifically bind modified histones and chromatin modifying enzymes such as KAT5/TIP60, probably explains its trancription activation activity.Apbb1 functions in association with TSHZ3, SET and HDAC factors as a transcriptional repressor, that inhibits the expression of CASP4. Apbb1 is associates with chromatin in a region surrounding the CASP4 transcriptional start site(s).
Uniprot IDQ9QXJ1
Protein Accession #NP_033815
Nucleotide Accession #NM_009685
Protein Size (# AA)708
Molecular Weight78kDa
Protein InteractionsRnf157; Enah; Prnp; APP; APLP2; APLP1; Evl;