Apbb1 Antibody - N-terminal region - Biotin
Referência ARP55471_P050-Biotin
Tamanho : 100ul
Marca : Aviva Systems Biology
Apbb1 Antibody - N-terminal region : Biotin (ARP55471_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-Apbb1 (ARP55471_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: DGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNP |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Apbb1 (ARP55471_P050-Biotin) antibody is Catalog # AAP55471 (Previous Catalog # AAPP33363) |
| Gene Symbol | Apbb1 |
|---|---|
| Gene Full Name | Amyloid beta (A4) precursor protein-binding, family B, member 1 |
| Alias Symbols | Rir, Fe65 |
| NCBI Gene Id | 11785 |
| Protein Name | Amyloid beta A4 precursor protein-binding family B member 1 |
| Description of Target | Apbb1 is an adapter protein that forms a transcriptionally active complex with the gamma-secretase-derived amyloid precursor protein (APP) intracellular domain.Apbb1 plays a central role in the response to DNA damage by translocating to the nucleus and inducing apoptosis. Apbb1 may act by specifically recognizing and binding histone H2AX phosphorylated on 'Tyr-142' (H2AXY142ph) at double-strand breaks (DSBs), recruiting other pro-apoptosis factors such as MAPK8/JNK1. Apbb1 is required for histone H4 acetylation at double-strand breaks (DSBs). Its ability to specifically bind modified histones and chromatin modifying enzymes such as KAT5/TIP60, probably explains its trancription activation activity.Apbb1 functions in association with TSHZ3, SET and HDAC factors as a transcriptional repressor, that inhibits the expression of CASP4. Apbb1 is associates with chromatin in a region surrounding the CASP4 transcriptional start site(s). |
| Uniprot ID | Q9QXJ1 |
| Protein Accession # | NP_033815 |
| Nucleotide Accession # | NM_009685 |
| Protein Size (# AA) | 708 |
| Molecular Weight | 78kDa |
| Protein Interactions | Rnf157; Enah; Prnp; APP; APLP2; APLP1; Evl; |




