A27L Recombinant Protein (Smallpox virus)
Referência OPCA05409-100UG
Tamanho : 100ug
Marca : Aviva Systems Biology
A27L Recombinant Protein (Smallpox virus) (OPCA05409)
Datasheets/Manuals | Printable datasheet for A27L Recombinant Protein (Smallpox virus) (OPCA05409) |
---|
Predicted Species Reactivity | Variola virus|Variola Virus |
---|---|
Product Format | Liquid or Lyophilized powder |
Reconstitution and Storage | -20°C or -80°C |
Peptide Sequence | MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE |
Source | Mammalian Cells |
Gene Symbol | A30L |
---|---|
Gene Full Name | hypothetical protein |
Alias Symbols | hypothetical protein, VARVgp134. |
NCBI Gene Id | 1486508 |
Protein Name | 14 kDa fusion protein |
Description of Target | Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion (By similarity). |
Uniprot ID | P33816 |
Protein Size (# AA) | Full Length |
Molecular Weight | 15.0 kDa |